PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02422.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 294aa    MW: 33088 Da    PI: 8.263
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02422.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.93.1e-1753113257
                              T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                 Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                              + R+++++eq+++Le+ F++   +p +ee++++ ++l    ++ ++ V++WFqNr+ + k+
  Rsa1.0_02422.1_g00001.1  53 KLRWNPKPEQIRILEAIFNSgMVNPPREEIRRIRAQLqeygQVGDASVFYWFQNRKSRSKN 113
                              78*****************99*************************************995 PP

2Wus_type_Homeobox107.76.7e-3553114364
        Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                              + RW+P+peQi+iLe++++sG+++P++eei+ri+a+L+eyG+++d+ VfyWFQNrk+R+++k
  Rsa1.0_02422.1_g00001.1  53 KLRWNPKPEQIRILEAIFNSGMVNPPREEIRRIRAQLQEYGQVGDASVFYWFQNRKSRSKNK 114
                              78**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-633113IPR009057Homeodomain-like
PROSITE profilePS5007110.46349114IPR001356Homeobox domain
SuperFamilySSF466891.07E-1150117IPR009057Homeodomain-like
SMARTSM003891.6E-751118IPR001356Homeobox domain
CDDcd000861.79E-752114No hitNo description
PfamPF000466.3E-1553112IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPHHHQ WQHDINSPLL PSSASHRSSP FSGCEVERSP EPKLRWNPKP  60
EQIRILEAIF NSGMVNPPRE EIRRIRAQLQ EYGQVGDASV FYWFQNRKSR SKNKLRLLHK  120
HSLSQPQPSS SSSSSSSKST KPQKNKDTNN NNLSLGGSQM MGMFPSEDAL PFPVSTAVAF  180
EGINVSSQLG FLSGDMKPAP PTVEPCTDYL LSEIMNSNVI YGTYHHQHLS EEEYEEMRMK  240
MLQQPQPYAT TSNQITSYNN NNIILHVPPI TSTTTATSDP LDIVPSTDQL QVQG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2514011e-115AY251401.1 Arabidopsis thaliana WOX9 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009132964.11e-160PREDICTED: WUSCHEL-related homeobox 9-like isoform X1
SwissprotQ6X7J41e-132WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBLM4E2F91e-160M4E2F9_BRARP; Uncharacterized protein
STRINGBra022960.1-P1e-159(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72062640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.11e-121homeobox-3